PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC2462_p3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family TALE
Protein Properties Length: 443aa    MW: 50205.3 Da    PI: 6.8007
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC2462_p3genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.82.1e-092963272354
                 SS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
    Homeobox  23 rypsaeereeLAkklgLterqVkvWFqNrRak 54 
                 ryp+++e+  LAk++gL+++qV +WF N R +
  RrC2462_p3 296 RYPKESEKIMLAKQTGLSKNQVANWFINARVR 327
                 8*****************************88 PP

2BELL123.86.7e-40199270172
        BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                 erqelq+kk+kLl++++eVdkrY+qy++q+++++ssFe+vag+g+akpYts+Al++iSrhFrcL+dai+eq+
  RrC2462_p3 199 ERQELQSKKNKLLTMVDEVDKRYNQYYHQMEALASSFEMVAGHGAAKPYTSVALNRISRHFRCLRDAIKEQV 270
                 79********************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.3E-51135268IPR006563POX domain
PfamPF075261.6E-48141266IPR006563POX domain
SMARTSM003893.8E-7256335IPR001356Homeobox domain
PROSITE profilePS5007110.965296331IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.4E-17296337IPR009057Homeodomain-like
SuperFamilySSF466893.29E-12296339IPR009057Homeodomain-like
CDDcd000867.17E-9296332No hitNo description
PfamPF059202.8E-12297327IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 443 aa     Download sequence    Send to blast
MAVYYPTSVG MQSLYQEPIY LNEQPQQQQQ QQASSSGAGA GVNCLEIPNS VPNEMVFIPP  60
TSDASLINGN VTVVSSNDLS FHGGGLSLSL GNQIQYHYQN LSNQFSYNNH HNPDENVKSH  120
HHHHHQVPSF GFYNNGFVSS VLRSRYLKPT QQLLDEVVSV KKTNKNNNNE KGQDFTDGSK  180
PNDNNNNTEK NAQNLSPTER QELQSKKNKL LTMVDEVDKR YNQYYHQMEA LASSFEMVAG  240
HGAAKPYTSV ALNRISRHFR CLRDAIKEQV QVIRGKLGEN KESCEDQQGE RIPRLRYPKE  300
SEKIMLAKQT GLSKNQVANW FINARVRLWK PMIEEMYKEE FGDSPELLSN SNQDSSSNKK  360
KRMNETSQLK HEDSSSSQQQ NHGNNNIHYT SDAEENLIFA DPKPDSLMNY NGFGVGDYNG  420
YIGLGNQQDG RFSNPHQLHD FVV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013693278.10.0PREDICTED: BEL1-like homeodomain protein 3
RefseqXP_013693285.10.0PREDICTED: BEL1-like homeodomain protein 3
SwissprotQ9FWS90.0BLH3_ARATH; BEL1-like homeodomain protein 3
TrEMBLA0A078HN930.0A0A078HN93_BRANA; BnaA02g17200D protein
STRINGBra008197.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM38201959
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75410.21e-171BEL1-like homeodomain 3